USF1

USF1
Dostupne strukture
PDBPretraga ortologa: PDBe RCSB
Spisak PDB ID kodova

1AN4

Identifikatori
AliasiUSF1
Vanjski ID-jeviOMIM: 191523 MGI: 99542 HomoloGene: 31426 GeneCards: USF1
Lokacija gena (čovjek)
Hromosom 1 (čovjek)
Hrom.Hromosom 1 (čovjek)[1]
Hromosom 1 (čovjek)
Genomska lokacija za USF1
Genomska lokacija za USF1
Bend1q23.3Početak161,039,251 bp[1]
Kraj161,045,977 bp[1]
Lokacija gena (miš)
Hromosom 1 (miš)
Hrom.Hromosom 1 (miš)[2]
Hromosom 1 (miš)
Genomska lokacija za USF1
Genomska lokacija za USF1
Bend1 H3|1 79.4 cMPočetak171,238,881 bp[2]
Kraj171,246,710 bp[2]
Ontologija gena
Molekularna funkcija vezivanje sa DNK
protein dimerization activity
GO:0001131, GO:0001151, GO:0001130, GO:0001204 DNA-binding transcription factor activity
histone deacetylase binding
bHLH transcription factor binding
GO:0001948, GO:0016582 vezivanje za proteine
protein heterodimerization activity
vezivanje enzima
double-stranded DNA binding
protein kinase binding
protein homodimerization activity
transcription factor activity, RNA polymerase II distal enhancer sequence-specific binding
sequence-specific DNA binding
vezivanje identičnih proteina
GO:0001200, GO:0001133, GO:0001201 DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0032403 protein-containing complex binding
Ćelijska komponenta transcription regulator complex
jedro
NURF complex
Set1C/COMPASS complex
nukleoplazma
Biološki proces carbon catabolite regulation of transcription
negative regulation of fibrinolysis
response to hypoxia
GO:0009373 regulation of transcription, DNA-templated
glucose homeostasis
GO:0044324, GO:0003256, GO:1901213, GO:0046019, GO:0046020, GO:1900094, GO:0061216, GO:0060994, GO:1902064, GO:0003258, GO:0072212 regulation of transcription by RNA polymerase II
late viral transcription
transcription by RNA polymerase II
transcription, DNA-templated
GO:0060469, GO:0009371 positive regulation of transcription, DNA-templated
regulation of transcription from RNA polymerase II promoter by glucose
glucose metabolic process
cellular response to insulin stimulus
GO:0003257, GO:0010735, GO:1901228, GO:1900622, GO:1904488 positive regulation of transcription by RNA polymerase II
positive regulation of transcription from RNA polymerase II promoter by glucose
lipid homeostasis
response to UV
Izvori:Amigo / QuickGO
Ortolozi
VrsteČovjekMiš
Entrez
Ensembl
UniProt
RefSeq (mRNK)

NM_207005
NM_001276373
NM_007122

NM_009480
NM_001305676
NM_001305677
NM_001305678

RefSeq (bjelančevina)

NP_001263302
NP_009053
NP_996888

NP_001292605
NP_001292606
NP_001292607
NP_033506

Lokacija (UCSC)Chr 1: 161.04 – 161.05 MbChr 1: 171.24 – 171.25 Mb
PubMed pretraga[3][4]
Wikipodaci
Pogledaj/uredi – čovjekPogledaj/uredi – miš

Uzvodni stimulatorni i faktor 1 jest protein koji je kod ljudi kodiran genom USF1 sa hromosoma 1.[5][6]

Aminokiselinska sekvenca

[uredi | uredi izvor]

Dužina polipeptidnog lanca je 310 aminokiselina, a molekulska težina 33.538 Da.[7]

1020304050
MKGQQKTAETEEGTVQIQEGAVATGEDPTSVAIASIQSAATFPDPNVKYV
FRTENGGQVMYRVIQVSEGQLDGQTEGTGAISGYPATQSMTQAVIQGAFT
SDDAVDTEGTAAETHYTYFPSTAVGDGAGGTTSGSTAAVVTTQGSEALLG
QATPPGTGQFFVMMSPQEVLQGGSQRSIAPRTHPYSPKSEAPRTTRDEKR
RAQHNEVERRRRDKINNWIVQLSKIIPDCSMESTKSGQSKGGILSKACDY
IQELRQSNHRLSEELQGLDQLQLDNDVLRQQVEDLKNKNLLLRAQLRHHG
LEVVIKNDSN

Funkcija

[uredi | uredi izvor]

Ovaj gen kodira člana porodice bazni heliks-petlja-heliks leucinskih zatvarača i može funkcionirati kao ćelijski transkripcijski faktor. Kodirani protein može aktivirati transkripciju preko inicijatorskog (Inr) elementa i E-kutijskog motiva bogatih pirimidinom. Ovaj gen je povezan sa porodičnom kombinovanom hiperlipidemijom (FCHL). Za ovaj gen identificirane su dvije varijante transkripta koje kodiraju različite izoforme su.[6]

Studija na miševima je pokazala da smanjeni nivoi USF1 povećavaju metabolizam smeđe masti.[8]

Interakcije

[uredi | uredi izvor]

Pokazano je da USF1 (ljudski gen) ima interakscije sa USF2,[9][10] FOSL1,[11] I GTF2I.[12][13]

Reference

[uredi | uredi izvor]
  1. ^ a b c GRCh38: Ensembl release 89: ENSG00000158773 - Ensembl, maj 2017
  2. ^ a b c GRCm38: Ensembl release 89: ENSMUSG00000026641 - Ensembl, maj 2017
  3. ^ "Human PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  4. ^ "Mouse PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  5. ^ Shieh BH, Sparkes RS, Gaynor RB, Lusis AJ (Apr 1993). "Localization of the gene-encoding upstream stimulatory factor (USF) to human chromosome 1q22-q23". Genomics. 16 (1): 266–8. doi:10.1006/geno.1993.1174. PMID 8486371.
  6. ^ a b "Entrez Gene: USF1 upstream transcription factor 1".
  7. ^ "UniProt, P22415" (jezik: en.). Pristupljeno 10. 12. 2021.CS1 održavanje: nepoznati jezik (link)
  8. ^ Laurila PP, Soronen J, Kooijman S, Forsström S, Boon MR, Surakka I, et al. (2016). "USF1 deficiency activates brown adipose tissue and improves cardiometabolic health". Science Translational Medicine. 8 (323): 323ra13. doi:10.1126/scitranslmed.aad0015. PMID 26819196. S2CID 24737539.
  9. ^ Ewing RM, Chu P, Elisma F, Li H, Taylor P, Climie S, McBroom-Cerajewski L, Robinson MD, O'Connor L, Li M, Taylor R, Dharsee M, Ho Y, Heilbut A, Moore L, Zhang S, Ornatsky O, Bukhman YV, Ethier M, Sheng Y, Vasilescu J, Abu-Farha M, Lambert JP, Duewel HS, Stewart II, Kuehl B, Hogue K, Colwill K, Gladwish K, Muskat B, Kinach R, Adams SL, Moran MF, Morin GB, Topaloglou T, Figeys D (2007). "Large-scale mapping of human protein-protein interactions by mass spectrometry". Molecular Systems Biology. 3 (1): 89. doi:10.1038/msb4100134. PMC 1847948. PMID 17353931.
  10. ^ Viollet B, Lefrançois-Martinez AM, Henrion A, Kahn A, Raymondjean M, Martinez A (Jan 1996). "Immunochemical characterization and transacting properties of upstream stimulatory factor isoforms". The Journal of Biological Chemistry. 271 (3): 1405–15. doi:10.1074/jbc.271.3.1405. PMID 8576131.
  11. ^ Pognonec P, Boulukos KE, Aperlo C, Fujimoto M, Ariga H, Nomoto A, Kato H (maj 1997). "Cross-family interaction between the bHLHZip USF and bZip Fra1 proteins results in down-regulation of AP1 activity". Oncogene. 14 (17): 2091–8. doi:10.1038/sj.onc.1201046. PMID 9160889.
  12. ^ Roy AL, Du H, Gregor PD, Novina CD, Martinez E, Roeder RG (Dec 1997). "Cloning of an inr- and E-box-binding protein, TFII-I, that interacts physically and functionally with USF1". The EMBO Journal. 16 (23): 7091–104. doi:10.1093/emboj/16.23.7091. PMC 1170311. PMID 9384587.
  13. ^ Roy AL, Meisterernst M, Pognonec P, Roeder RG (Nov 1991). "Cooperative interaction of an initiator-binding transcription initiation factor and the helix-loop-helix activator USF". Nature. 354 (6350): 245–8. Bibcode:1991Natur.354..245R. doi:10.1038/354245a0. PMID 1961251. S2CID 4260885.

Dopunska literatura

[uredi | uredi izvor]

Vanjski linkovi

[uredi | uredi izvor]