CXCL7

PPBP
Dostupne strukture
PDBPretraga ortologa: PDBe RCSB
Spisak PDB ID kodova

1TVX, 1F9P, 1NAP

Identifikatori
AliasiPPBP
Vanjski ID-jeviOMIM: 121010 MGI: 1888712 HomoloGene: 136759 GeneCards: PPBP
Lokacija gena (čovjek)
Hromosom 4 (čovjek)
Hrom.Hromosom 4 (čovjek)[1]
Hromosom 4 (čovjek)
Genomska lokacija za PPBP
Genomska lokacija za PPBP
Bend4q13.3Početak73,986,439 bp[1]
Kraj73,988,190 bp[1]
Lokacija gena (miš)
Hromosom 5 (miš)
Hrom.Hromosom 5 (miš)[2]
Hromosom 5 (miš)
Genomska lokacija za PPBP
Genomska lokacija za PPBP
Bend5|5 E1Početak90,916,377 bp[2]
Kraj90,917,922 bp[2]
Obrazac RNK ekspresije
Više referentnih podataka o ekspresiji
Ontologija gena
Molekularna funkcija growth factor activity
cytokine activity
glucose transmembrane transporter activity
CXCR chemokine receptor binding
chemokine activity
GO:0001948, GO:0016582 vezivanje za proteine
Ćelijska komponenta platelet alpha granule lumen
extracellular region
Vanćelijsko
tertiary granule lumen
platelet alpha granule
Biološki proces response to lipopolysaccharide
regulation of cell population proliferation
Hemotaksija
positive regulation of cell division
platelet degranulation
defense response to bacterium
inflammatory response
GO:0046730, GO:0046737, GO:0046738, GO:0046736 Imuni odgovor
chemokine-mediated signaling pathway
defense response
positive regulation of neutrophil chemotaxis
antimicrobial humoral immune response mediated by antimicrobial peptide
regulation of signaling receptor activity
neutrophil degranulation
cell chemotaxis
G protein-coupled receptor signaling pathway
glucose transmembrane transport
neutrophil chemotaxis
leukocyte chemotaxis
cellular response to lipopolysaccharide
Izvori:Amigo / QuickGO
Ortolozi
VrsteČovjekMiš
Entrez
Ensembl
UniProt
RefSeq (mRNK)

NM_002704

NM_023785

RefSeq (bjelančevina)

NP_002695

NP_076274

Lokacija (UCSC)Chr 4: 73.99 – 73.99 MbChr 5: 90.92 – 90.92 Mb
PubMed pretraga[3][4]
Wikipodaci
Pogledaj/uredi – čovjekPogledaj/uredi – miš

Hemokinski ligand 7 (C-X-C motiv) jest ljudski gen na lokusu CXCL7 sa hromosoma 4.[5]

Aminokiselinska sekvenca

[uredi | uredi izvor]

Dužina polipeptidnog lanca je 128 aminokiselina, а molekulska težina 13.894 Da.[6]

1020304050
MSLRLDTTPSCNSARPLHALQVLLLLSLLLTALASSTKGQTKRNLAKGKE
ESLDSDLYAELRCMCIKTTSGIHPKNIQSLEVIGKGTHCNQVEVIATLKD
GRKICLDPDAPRIKKIVQKKLAGDESAD

Funkcija

[uredi | uredi izvor]

Kodirani protein, hemokinski ligand 7 (C-X-C motiv) je mali citokin koji pripada porodici CXC hemokina. To je izoforma beta-tromboglobulina ili osnovnog protrombocitnog proteina (PPBP).[7]

To je protein koji se oslobađa u velikim količinama iz trombocita, nakon njihove aktivacije.[8] Stimulira različite procese uključujući mitogenezu, sintezu vanćelijskog matriksa, metabolizam glukoze i sintezu aktivatora plazminogena.[9][10]

Reference

[uredi | uredi izvor]
  1. ^ a b c GRCh38: Ensembl release 89: ENSG00000163736 - Ensembl, maj 2017
  2. ^ a b c GRCm38: Ensembl release 89: ENSMUSG00000029372 - Ensembl, maj 2017
  3. ^ "Human PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  4. ^ "Mouse PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  5. ^ "Entrez Gene: PPBP pro-platelet basic protein (chemokine (C-X-C motif) ligand 7)".
  6. ^ "UniProt, P02775" (jezik: engleski). Pristupljeno 23. 10. 2021.
  7. ^ Hristov M, Zernecke A, Bidzhekov K, et al. (mart 2007). "Importance of CXC chemokine receptor 2 in the homing of human peripheral blood endothelial progenitor cells to sites of arterial injury". Circ. Res. 100 (4): 590–7. doi:10.1161/01.RES.0000259043.42571.68. PMID 17272812.
  8. ^ Majumdar S, Gonder D, Koutsis B, Poncz M (1991). "Characterization of the human beta-thromboglobulin gene. Comparison with the gene for platelet factor 4". J Biol Chem. 266 (9): 5785–9. doi:10.1016/S0021-9258(19)67665-9. PMID 1826003.
  9. ^ Castor C, Miller J, Walz D (1983). "Structural and biological characteristics of connective tissue activating peptide (CTAP-III), a major human platelet-derived growth factor". Proc Natl Acad Sci USA. 80 (3): 765–9. Bibcode:1983PNAS...80..765C. doi:10.1073/pnas.80.3.765. PMC 393460. PMID 6572368.
  10. ^ Castor C, Furlong A, Carter-Su C (1985). "Connective tissue activation: stimulation of glucose transport by connective tissue activating peptide III". Biochemistry. 24 (7): 1762–7. doi:10.1021/bi00328a029. PMID 4005226.

Dopunska literatura

[uredi | uredi izvor]

Vanjski linkovi

[uredi | uredi izvor]